The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RNA binding domain in the human muscleblind-like protein 2. Protein Sci. 18 80-91 2009
    Site RSGI
    PDB Id 2e5s Target Id hso002001995.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12999, Molecular Weight 10229.13 Da.
    Residues 91 Isoelectric Point 8.83
    Sequence statqkllrtdklevcrefqrgncargetdcrfahpadstmidtsdntvtvcmdyikgrcmrekckyfh ppahlqakikaaqhqanqaava
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch