.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e5x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of nucleotide triphosphate pyrophosphatase from pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2e5x Target Id pho001001917.5
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14019, Molecular Weight 21203.40 Da.
    Residues 186 Isoelectric Point 7.83
    Sequence mkiffitsnpgkvrevanflgtfgieivqlkheypeiqaekledvvdfgiswlkgkvpqpfmiedsglf ieslkgfpgvyssyvyrtiglegilklmegaedrrayfksvigfyidgkaykfsgvtwgrisnekrgth gfgydpifipegsektfaemtieeknalshrgkalkaffewlkvnlky
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.222
    Matthews' coefficent 3.24 Rfactor 0.196
    Waters 197 Solvent Content 61.99

    Ligand Information
    Ligands ITT (INOSINE) x 1;EDO (1,2-ETHANEDIOL) x 2
    Metals NA (SODIUM) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch