.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e60

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the surp1 domain in splicing factor, arginine/serine-rich 8. To be Published
    Site RSGI
    PDB Id 2e60 Target Id hso002001530.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12986, Molecular Weight 10710.83 Da.
    Residues 94 Isoelectric Point 9.48
    Sequence vaplglsvpsdvelpptakmhaiiertasfvcrqgaqfeimlkakqarnsqfdflrfdhylnpyykfiq kamkegrytvlaenksdekkksgvs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch