The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the cwf21 domain in protein AAK25922. To be Published
    Site RSGI
    PDB Id 2e62 Target Id atr001109625.1
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS12259, Molecular Weight 6605.12 Da.
    Residues 54 Isoelectric Point 5.19
    Sequence ngmdeeqrqkrrrievalieyretleeqgmknpeeierkveinrkrlevdygls
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch