The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the YdjC-family protein TTHB029 from Thermus thermophilus HB8: structural relationship with peptidoglycan N-acetylglucosamine deacetylase. Biochem.Biophys.Res.Commun. 367 535-541 2008
    Site RSGI
    PDB Id 2e67 Target Id ttk003001525.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14737, Molecular Weight 29597.29 Da.
    Residues 264 Isoelectric Point 5.38
    Sequence mdllerlglggrrvlilhhddlglthaqngayqalglptgsvmvpgawasgvkgedlgvhlvltsewpa prmrpltegeslrdeagyfpeslealwrkaraeeverelkaqiqaaaklfspthldahqgavlrpdlae vylrlaeayrlvplvpesleglgvpppflpelerllyetpfpqvrfldpyglppeerlgfyldlahlpp glyylvhhsalptpegralpdwptreadyfalshpevrrvlaefhpltwravrealf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.90 Rfree 0.25934
    Matthews' coefficent 3.90 Rfactor 0.21904
    Waters 132 Solvent Content 68.20

    Ligand Information
    Metals MG (MAGNESIUM) x 6



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch