.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e6k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of Thermus thermophilus HB8 TT0505. To be Published
    Site RSGI
    PDB Id 2e6k Target Id ttk003000505.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14397, Molecular Weight 71875.37 Da.
    Residues 651 Isoelectric Point 6.12
    Sequence mketrdletlsvnairflaidavekarsghpgmpmgmaplayllfrevmrhnpldpdwpdrdrfvlsag hgsmllyavlhltgydlpleelksfrqwgsktpghperghtpgvevttgplgqgistavglalaerkla aefnrpghvvvdhytyvlasdgdlmegvsgeaaslaghwglsklivfwddnrisidgptdlaftedvla ryraygwqtlrvedvndlealrkaiklaklderptliavrshigfgspkqdsakahgeplgpeaveatr rnlgwpyppfvvpeevyrhmdmrekgrawqeawekaleayaraypdlhqelmrrlrgelpplpeeppsf dkpiatraasgralnllaprlpellggsadltpsnntkaegmedfsranplgrylhfgvrehamgailn glnlhggyrayggtflvfsdymrpairlaalmgvptvfvfthdsialgedgpthqpvehlmslrampnl fvirpadayetfyawlvalrrkegptalvltrqavpllspekargllrggyvledveepqgvlvatgse vhlalraqallrekgvrvrvvslpsfelfaaqpeayrkevlppglpvvaveagaslgweryahkvvald rfgasapypevyerlgftpervaeaflslv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.09 Rfree 0.259
    Matthews' coefficent 2.37 Rfactor 0.217
    Waters 1612 Solvent Content 48.10

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch