.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e6r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the PHD domain in SmcY protein. To be Published
    Site RSGI
    PDB Id 2e6r Target Id hso002001234.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12965, Molecular Weight 9015.71 Da.
    Residues 79 Isoelectric Point 4.46
    Sequence hssaqfidsyicqvcsrgdeddkllfcdgcddnyhifcllpplpeiprgiwrcpkcilaeckqppeafg feqatqeysl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch