The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of TT1592 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2e6x Target Id ttk003001592.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14751, Molecular Weight 8137.04 Da.
    Residues 69 Isoelectric Point 5.44
    Sequence mekdlldklgqhlvwrmgraededvlvvrvglasatprfrelprllnlpeaemrrlvqegrvrvewvee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.253
    Matthews' coefficent 1.99 Rfactor 0.214
    Waters 175 Solvent Content 38.14

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch