The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the PDZ domain from Human MAGUK p55 subfamily member 2. To be Published
    Site RSGI
    PDB Id 2e7k Target Id hso002001131.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12956, Molecular Weight 8290.31 Da.
    Residues 78 Isoelectric Point 9.68
    Sequence rmvgirktagehlgvtfrveggelviarilhggmvaqqgllhvgdiikevngqpvgsdpralqellrna sgsvilkil
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch