.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e7v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of SEA domain of transmembrane protease from Mus musculus. To be Published
    Site RSGI
    PDB Id 2e7v Target Id mmi002015285.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13391, Molecular Weight 13887.00 Da.
    Residues 121 Isoelectric Point 9.64
    Sequence dkkayfyhssfqilnveytealnspatheyrtlserieamitdefrgsslksefirthvvklrkegtgv vadvvmkfrsskrnnrkvmktriqsvlrrlsssgnleiapsneitsltdqdt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.92 Rfree 0.241
    Matthews' coefficent 1.73 Rfactor 0.191
    Waters 54 Solvent Content 28.97

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch