.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e7y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of the flexible arm of Thermotoga maritima tRNase Z differs from those of homologous enzymes. Acta Crystallogr.,Sect.F 63 637-641 2007
    Site RSGI
    PDB Id 2e7y Target Id ar_001000499.2
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS12168, Molecular Weight 32655.90 Da.
    Residues 280 Isoelectric Point 9.12
    Sequence mniigfskalfstwiyysperilfdagegvsttlgskvyafkyvflthghvdhiaglwgvvnirnngmg drekpldvfypegnraveeytefikranpdlrfsfnvhplkegervflrnaggfkryvqpfrtkhvsse vsfgyhifevrrklkkefqgldskeisrlvkekgrdfvteeyhkkvltisgdslaldpeeirgtellih ectfldardrryknhaaidevmesvkaagvkkvilyhistryirqlksvikkyreempdveilymdprk vfem
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.97 Rfree 0.249
    Matthews' coefficent 3.22 Rfactor 0.204
    Waters 325 Solvent Content 61.75

    Ligand Information
    Ligands SO4 (SULFATE) x 2;PGO (S-1,2-PROPANEDIOL) x 4
    Metals ZN (ZINC) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch