.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e85

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hydrogenase maturating endopeptidase HycI from Escherichia coli. Biochem.Biophys.Res.Commun. 389 310-314 2009
    Site RSGI
    PDB Id 2e85 Target Id eco002002687.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12283, Molecular Weight 17023.54 Da.
    Residues 156 Isoelectric Point 4.06
    Sequence vtdvllcvgnsmmgddgagpllaekcaaapkgnwvvidggsapendivairelrptrllivdatdmgln pgeiriidpddiaemfmmtthnmplnylidqlkedigeviflgiqpdivgfyypmtqpikdavetvyqr legwegnggfaqlaveee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.258
    Matthews' coefficent 2.36 Rfactor 0.248
    Waters 275 Solvent Content 47.97

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 6

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch