.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e87

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical GTP-binding protein PH1320 from Pyrococcus horikoshii OT3, in complex with GDP. To be Published
    Site RSGI
    PDB Id 2e87 Target Id pho001001320.3
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13988, Molecular Weight 41491.81 Da.
    Residues 357 Isoelectric Point 9.20
    Sequence mrnpfermptvltadelidkafrraekaassfkprgnkvkkarlreelrvrtvsnvvrdnlrkvlertp glstlpkfyqelvdvlvdrdtfhkamagidwairiireleeryverirysndpneiaelrrqfygrvas vlrdiddrlrylnkarevlkdlpvvdleiptvviaghpnvgkstllkalttakpeiasypfttrginvg qfedgyfryqiidtpglldrpiserneiekqailalrylgnliiyifdpsehcgfpleeqihlfeevhg efkdlpflvvinkidvadeenikrlekfvkekglnpikisalkgtgidlvkeeiiktlrplaekvarek ierelrryrsyl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.35 Rfree 0.255
    Matthews' coefficent 3.54 Rfactor 0.221
    Waters 52 Solvent Content 65.28

    Ligand Information
    Ligands SO4 (SULFATE) x 4;GDP (GUANOSINE-5'-DIPHOSPHATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch