.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e88

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Direct inter-subdomain interactions switch between the closed and open forms of the Hsp70 nucleotide-binding domain in the nucleotide-free state. Acta Crystallogr.,Sect.D 66 223-232 2010
    Site RSGI
    PDB Id 2e88 Target Id hss001003817.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13347, Molecular Weight 42700.11 Da.
    Residues 388 Isoelectric Point 6.35
    Sequence makaaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvalnpqntvfd akrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeissmvltkmkeiaeaylgyp vtnavitvpayfndsqrqatkdagviaglnvlriineptaaaiaygldrtgkgernvlifdlgggtfdv siltiddgifevkatagdthlggedfdnrlvnhfveefkrkhkkdisqnkravrrlrtacerakrtlss stqasleidslfegidfytsitrarfeelcsdlfrstlepvekalrdakldkaqihdlvlvggstripk vqkllqdffngrdlnksinpdeavaygaavqaailmgdksenv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.239
    Matthews' coefficent 2.37 Rfactor 0.193
    Waters 416 Solvent Content 48.13

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch