.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e8c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein (Aq_1549) from Aquifex aeolicus VF5. To be Published
    Site RSGI
    PDB Id 2e8c Target Id aae001001549.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12071, Molecular Weight 15011.84 Da.
    Residues 132 Isoelectric Point 7.70
    Sequence mevkevelelsseatflsktsigeitagekglnpmelllvsigscsgvdvyhilkkkrqevkdikiflk gkrrekhpkiyeeieikyvavgkveekaleqavklstekycsvlamvkpstnlkiswevkwee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.251
    Matthews' coefficent 2.13 Rfactor 0.213
    Waters 50 Solvent Content 42.18

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch