.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e8n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the C-terminal SAM-domain of EphaA2: Ephrin type-A receptor 2 precursor (EC 2.7.10.1). To be Published
    Site RSGI
    PDB Id 2e8n Target Id hsg002000008.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12324, Molecular Weight 8503.45 Da.
    Residues 75 Isoelectric Point 8.37
    Sequence egvpfrtvsewlesikmqqytehfmaagytaiekvvqmtnddvkrigvrlpghqkriaysllglkdqvn tvgipi
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch