The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of T.th.HB8 Argininosuccinate lyase complexed with L-Arginine. To be published
    Site RSGI
    PDB Id 2e9f Target Id ttk003000040.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14200, Molecular Weight 51911.73 Da.
    Residues 462 Isoelectric Point 5.99
    Sequence mahrtwggrfgegpdalaarfnaslafdralwredlwqnrvharmlhavgllsaeeleailkgldriee eieagtfpwreeledvhmnlearltelvgppggklhtarsrndqvatdlrlylrgaidellalllalrr vlvreaekhldplyvlpgythlqraqpvllahwflayyemlkrdagrledakerlnesplgaaalagtg fpidrhftarelgfkapmrnsldavasrdfalevlsalnigmlhlsrmaeelilysteefgfvevpdaf atgssimpqkknpdilelirakagrvlgafvglsavvkglplaynkdlqedkeplldalatyrdslrll aallpglkwrrermwraaeggytlateladylaekglpfreahhvvgrlvrrlveegralkdltleelq ahhplfaedalpllrletaihrrrsyggtapeavrerleeakkevgld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.80 Rfree 0.271
    Matthews' coefficent 2.91 Rfactor 0.205
    Waters 135 Solvent Content 57.69

    Ligand Information
    Ligands ARG x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch