The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the RING domain of the human ring finger protein 4. To be Published
    Site RSGI
    PDB Id 2ea6 Target Id hso002000288.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12905, Molecular Weight 6771.47 Da.
    Residues 62 Isoelectric Point 8.80
    Sequence tglrpsgtvscpicmdgyseivqngrlivstecghvfcsqclrdslknantcptcrkkinhk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch