.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eay

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Of Biotin Protein Ligase From Aquifex Aeolicus. To be Published
    Site RSGI
    PDB Id 2eay Target Id aae001000566.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12041, Molecular Weight 26655.66 Da.
    Residues 233 Isoelectric Point 8.91
    Sequence mfknliwlkevdstqerlkewnvsygtalvadrqtkgrgrlgrkwlsqegglyfsfllnpkefenllql plvlglsvsealeeiteipfslkwpndvyfqekkvsgvlcelskdklivgiginvnqreipeeikdrat tlyeitgkdwdrkevllkvlkrisenlkkfkeksfkefkgkieskmlylgeevkllgegkitgklvgls ekggalilteegikeilsgefslrrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.247
    Matthews' coefficent 2.27 Rfactor 0.214
    Waters 324 Solvent Content 45.93

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch