.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eb0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Methanococcus jannaschii inorganic pyrophosphatase. To be Published
    Site RSGI
    PDB Id 2eb0 Target Id mja001000608.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13372, Molecular Weight 34110.67 Da.
    Residues 307 Isoelectric Point 5.00
    Sequence mryvvghknpdtdsiasaivlayfldcyparlgdinpetefvlrkfgvmepeliesakgkeiilvdhse ksqsfddleegkliaiidhhkvgltttepilyyakpvgstatviaelyfkdaidliggkkkelkpdlag lllsaiisdtvlfksptttdldkemakklaeiagisnieefgmeilkaksvvgklkpeeiinmdfknfd fngkkvgigqvevidvseveskkediyklleeklknegydlivflitdimkegsealvvgnkemfekaf nvkvegnsvflegvmsrkkqvvpplerayng
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.271
    Matthews' coefficent 2.12 Rfactor 0.205
    Waters 426 Solvent Content 42.07

    Ligand Information
    Ligands
    Metals MN (MANGANESE) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch