.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eb7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the MarR family regulatory protein, ST1710, from Sulfolobus tokodaii strain 7. J.Struct.Biol. 161 9-17 2008
    Site RSGI
    PDB Id 2eb7 Target Id sto001001710.1
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14056, Molecular Weight 16854.62 Da.
    Residues 146 Isoelectric Point 6.41
    Sequence mlesnenriqimstiakiyramsrelnrrlgelnlsyldflvlratsdgpktmaylanryfvtqsaita svdkleemglvvrvrdredrrkilieitekgletfnkgieiykklanevtgdlsedevilvldkiskil krieeisq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.268
    Matthews' coefficent 2.16 Rfactor 0.228
    Waters 115 Solvent Content 43.15

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch