The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein from thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2ebg Target Id ttk003001907.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14821, Molecular Weight 11833.03 Da.
    Residues 106 Isoelectric Point 4.42
    Sequence mqavrlfqgylwhpralaldlkallpgevagarllwdevppptpffedgtpthtqrfyqltllvlteep pealkplaeeaaealgevleglppevgwllledlrpl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.262
    Matthews' coefficent 2.43 Rfactor 0.238
    Waters 209 Solvent Content 49.41

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch