.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ebs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Structural Basis for the Exo-mode of Action in GH74 Oligoxyloglucan Reducing End-specific Cellobiohydrolase. J.Mol.Biol. 370 53-62 2007
    Site RSGI
    PDB Id 2ebs Target Id my_001000024.1
    Molecular Characteristics
    Source Geotrichum sp. m128
    Alias Ids TPS13694, Molecular Weight 84893.55 Da.
    Residues 789 Isoelectric Point 5.29
    Sequence kehyefknvaiggggyitgivahpktkdllyartdiggayrwdagtskwiplndfieaqdmnimgtesi aldpnnpdrlylaqgryvgdewaafyvsedrgqsftiyespfpmgandmgrnngerlavnpfnsnevwm gtrtegiwkssdraktwtnvtsipdaftngigytsvifdperngtiyasatapqgmyvthdggvswepv agqpsswlnrttgafpdkkpasiapqpmkvaltpnflyvtyadypgpwgvtfgevwrqnrtsgawddit prvgnsspapynnqtfpaggfcglsvdatnpnrlvvitldrdpgpaldsiylstdagatwkdvtqlssp snlegnwghptnaarykdgtpvpwldfnngpqwggygaphgtpgltkfgwwmsavlidpfnpehlmygt gatiwatdtlsrvekdwapswylqidgieenailslrspksgaallsgigdisgmkhddltkpqkmfga pqfsnldsidaagnfpnvvvragssgheydsacargayatdggdawtifptcppgmnashyqgstiavd asgsqivwstkldeqasgpwyshdygktwsvpagdlkaqtanvlsdkvqdgtfyatdggkffvstdggk syaakgaglvtgtslmpavnpwvagdvwvpvpegglfhstdfgasftrvgtanatlvsvgapksksdgk kasapsavfiwgtdkpgsdiglyrsddngstwtrvndqehnysgptmieadpkvygrvylgtngrgivy adltnkksneekstakcangqkgthcyvkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.21925
    Matthews' coefficent 2.81 Rfactor 0.1585
    Waters 1078 Solvent Content 56.17

    Ligand Information
    Ligands BGC-XYS-BGC-XYS-BGC-XYS-BGC (BETA-D-GLUCOSE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch