.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ebt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of three tandem repeats of zf-C2H2 domains from human Kruppel-like factor 5. To be Published
    Site RSGI
    PDB Id 2ebt Target Id hso003006302.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13094, Molecular Weight 11102.06 Da.
    Residues 93 Isoelectric Point 9.63
    Sequence pdlekrrihycdypgctkvytksshlkahlrthtgekpykctwegcdwrfarsdeltrhyrkhtgakpf qcgvcnrsfsrsdhlalhmkrhqn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch