The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the third zf-RanBP domain from human Nuclear pore complex protein Nup153. to be published
    Site RSGI
    PDB Id 2ebv Target Id hso002001298.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12975, Molecular Weight 5238.58 Da.
    Residues 50 Isoelectric Point 5.99
    Sequence ssssctvttgtlgfgdkfkrpigswecsvccvsnnaednkcvscmsekpg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch