.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ecl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the RING domain of the human RING-box protein 2. To be Published
    Site RSGI
    PDB Id 2ecl Target Id hsi002007569.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12420, Molecular Weight 8711.65 Da.
    Residues 74 Isoelectric Point 5.49
    Sequence mwswdvecdtcaicrvqvmdaclrcqaenkqedcvvvwgecnhsfhnccmslwvkqnnrcplcqqdwvv qrigk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch