.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ecy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    {{ template.Protein{ leadContact:"", title:"Solution structure of the Zinc finger, C3HC4 type (RING finger)" domain of TNF receptor-associated factor 3. To be Published",site:'RSGI', status:'In PDB', date:"2009-11-01", targetid:"hsg001000026.1", pdbid:"2ecy", source:"Homo sapiens", relatedPDBs:[], refids:"", molwt:"6605.39", residues:"59", isopoint:"8.18", sequence:"fvktvedkykcekchlvlcspkqtecghrfcescmaallsssspkctacqesivkdkvf", method:"NMR", numchains:"1", resolution:"not", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"ZN (ZINC) x 2", model:"False", uniprot:"Q13114", pubmed:"" } }}

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch