The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the UQ_con domain from human NEDD8-conjugating enzyme NCE2. To be Published
    Site RSGI
    PDB Id 2edi Target Id hsi002010298.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12431, Molecular Weight 18487.08 Da.
    Residues 160 Isoelectric Point 5.86
    Sequence strrvsvrdkllvkevaeleanlpctckvhfpdpnklhcfqltvtpdegyyqggkfqfetevpdaynmv ppkvkcltkiwhpnitetgeiclsllrehsidgtgwaptrtlkdvvwglnslftdllnfddplnieaae hhlrdkedfrnkvddyikryar
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch