.
The Open Protein Structure Annotation Network
PDB Keyword
.

2edu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RSGI RUH-070, a C-terminal domain of kinesin-like protein KIF22 from human cDNA. To be Published
    Site RSGI
    PDB Id 2edu Target Id hsi002004837.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12378, Molecular Weight 10175.12 Da.
    Residues 91 Isoelectric Point 5.67
    Sequence ekaedcwelqispellahgrqkildllnegsardlrslqrigpkkaqlivgwrelhgpfsqvedlerve gitgkqmesflkanilglaagq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch