.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ee8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of three zf-C2H2 domains from mouse protein odd-skipped-related 2 splicing isoform 2. To be Published
    Site RSGI
    PDB Id 2ee8 Target Id mmi002014969.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13390, Molecular Weight 11676.83 Da.
    Residues 99 Isoelectric Point 9.64
    Sequence grlpsktkkefickfcgrhftksynlliherthtderpytcdichkafrrqdhlrdhryihskekpfkc qecgkgfcqsrtlavhktlhmqtssptaas
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch