.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eeh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of First PDZ domain of PDZ Domain Containing Protein 7. To be published
    Site RSGI
    PDB Id 2eeh Target Id hss001000688.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13213, Molecular Weight 9130.96 Da.
    Residues 87 Isoelectric Point 9.10
    Sequence sdiihsvrvekspagrlgfsvrggsehglgifvskveegssaeraglcvgdkitevnglslesttmgsa vkvltsssrlhmmvrrmg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch