The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of Fourth PDZ domain of PDZ Domain Containing Protein 1. To be Published
    Site RSGI
    PDB Id 2eej Target Id hss001001614.3
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13274, Molecular Weight 8920.78 Da.
    Residues 83 Isoelectric Point 5.79
    Sequence pklcrlakgengygfhlnairglpgsfikevqkggpadlaglededviievngvnvldepyekvvdriq ssgknvtllvcgkk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch