The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of GK0241 protein from Geobacillus kaustophilus. To be Published
    Site RSGI
    PDB Id 2eey Target Id gka001000241.1
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12288, Molecular Weight 19871.77 Da.
    Residues 183 Isoelectric Point 7.21
    Sequence mgsshhhhhhssgenlyfqghmssfthfneqgrakmvdithkedtvrvavaqtsvtvsreiyekmtsna iekgdvlavaqvagvmaakktadlipmchplmlkgvdiafawendgeahklvitatvktkgstgvemea ltaasvcaltvydmckaldkgmvigptylvektggksghyrrktd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.94 Rfree 0.192
    Matthews' coefficent 2.78 Rfactor 0.191
    Waters 128 Solvent Content 55.69

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch