.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eez

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of alanine dehydrogenase from themus thermophilus. To be Published
    Site RSGI
    PDB Id 2eez Target Id ttk003000361.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14348, Molecular Weight 38630.71 Da.
    Residues 369 Isoelectric Point 5.96
    Sequence mvigvpkeiktlenrvaltpggveslvrrghtvlvergagegsglsdaeyaragaelvgreeawgaemv vkvkeplpeeygflreglilftylhlaadrglteamlrsgvtgiayetvqlpdgtlpllvpmsevagrm apqvgaqflekpkggrgvllggvpgvapasvvilgggtvgtnaakialgmgaqvtildvnhkrlqyldd vfggrvitltateanikksvqhadlligavlvpgakapklvtrdmlslmkegavivdvavdqggcveti rptthaeptyvvdgvvhygvanmpgavprtstfaltnqtlpyvlklaekgldalledaallkglnthkg rlthpgvaeafglpytppeealrg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.71 Rfree 0.264
    Matthews' coefficent 2.83 Rfactor 0.22
    Waters 384 Solvent Content 56.53

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch