.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ef1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the extracellular domain of human CD38. To be Published
    Site RSGI
    PDB Id 2ef1 Target Id srz001000050.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS14029, Molecular Weight 29675.20 Da.
    Residues 256 Isoelectric Point 7.14
    Sequence rwrqqwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcniteedyqplmklg tqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefntskinyqscpdwrkdcsn npvsvfwktvsrrfaeaacdvvhvmlngsrskifdknstfgsvevhnlqpekvqtleawvihggredsr dlcqdptikelesiiskrniqfsckniyrpdkflqcvknpedssctsei
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.256
    Matthews' coefficent 2.49 Rfactor 0.203
    Waters 182 Solvent Content 50.54

    Ligand Information
    Ligands EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch