.
The Open Protein Structure Annotation Network
PDB Keyword
.

2efl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Curved EFC/F-BAR-Domain Dimers Are Joined End to End into a Filament for Membrane Invagination in Endocytosis. Cell(Cambridge,Mass.) 129 761-772 2007
    Site RSGI
    PDB Id 2efl Target Id ar_001000447.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12161, Molecular Weight 35572.18 Da.
    Residues 300 Isoelectric Point 5.71
    Sequence mswgtelwdqfdnlekhtqwgidilekyikfvkerteielsyakqlrnlskkyqpkknskeeeeykyts ckafisnlnemndyagqhevisenmasqiivdlaryvqelkqerksnfhdgrkaqqhietcwkqlessk rrferdckeadraqqyfekmdadinvtkadvekarqqaqirhqmaedskadyssilqkfnheqheyyht hipnifqkiqemeerrivrmgesmktyaevdrqvipiigkcldgivkaaesidqkndsqlvieayksgf eppgdiefedytqpmkrtvsdnsl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.61 Rfree 0.267
    Matthews' coefficent 3.11 Rfactor 0.212
    Waters 120 Solvent Content 60.44

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch