.
The Open Protein Structure Annotation Network
PDB Keyword
.

2efv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Hypothetical Protein(MJ0366) from Methanocaldococcus jannaschii. To be Published
    Site RSGI
    PDB Id 2efv Target Id mja001000366.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13370, Molecular Weight 10853.12 Da.
    Residues 92 Isoelectric Point 9.04
    Sequence mplvgfmkekkratfylyknidgrklryllhklenvenvdidtlrraieaekkykrsitlteeeeviiq rlgksanlllncelvkldegera
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.231
    Matthews' coefficent 2.51 Rfactor 0.219
    Waters 68 Solvent Content 50.97

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch