.
The Open Protein Structure Annotation Network
PDB Keyword
.

2efy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of T.th. HB8 O-acetylserine sulfhydrylase Complexed with 4-Acetylbutyric acid. to be published
    Site RSGI
    PDB Id 2efy Target Id ttk003000030.4
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14176, Molecular Weight 33023.37 Da.
    Residues 304 Isoelectric Point 6.39
    Sequence mrvegaigktpvvrlakvvepdmaevwvkleglnpggsikdrpawymikdaeergilrpgsgqvivept sgntgiglamiaasrgyrliltmpaqmseerkrvlkafgaelvltdperrmlaareealrlkeelgafm pdqfknpanvrahyettgpelyealegridafvygsgtggtitgvgrylkeriphvkviaveparsnvl sggkmgqhgfqgmgpgfipenldlslldgviqvweedafplarrlareeglflgmssggivwaalqvar elgpgkrvacispdggwkylstplyaep
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.35 Rfree 0.238
    Matthews' coefficent 2.50 Rfactor 0.193
    Waters 161 Solvent Content 50.83

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 2;4AT (5-OXOHEXANOIC) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch