.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eg0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Hypothetical Protein(GK2848) from Geobacillus kaustophilus. To be Published
    Site RSGI
    PDB Id 2eg0 Target Id gka001002848.1
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12314, Molecular Weight 22365.32 Da.
    Residues 203 Isoelectric Point 6.80
    Sequence mgsshhhhhhssgenlyfqghmiypykgktpqiaasafiadyvtitgdvvigeetsiwfntvirgdvap tvignrvniqdnsilhqspnnpliiedgvtvghqvilhsaivrknaligmgsiildraeigegafigag slvppgkkippntlalgrpakvvrelteddiremerirreyvekgqyykalqqqrtscadkkelp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.42 Rfree 0.254
    Matthews' coefficent 3.19 Rfactor 0.204
    Waters 77 Solvent Content 61.40

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch