.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eg4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Probable Thiosulfate Sulfurtransferase. To be Published
    Site RSGI
    PDB Id 2eg4 Target Id ttk003000346.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14340, Molecular Weight 25559.86 Da.
    Residues 230 Isoelectric Point 5.62
    Sequence mnlpedavlvdtrprpayeaghlpgarhldlsapklrlreeaelkaleggltelfqtlglrspvvlyde gltsrlcrtafflglgglevqlwtegwepyatekeepkpertevvaklrrdwlltadeaarhpllldvr speefqgkvhppccprggripgsknaplelflspegllerlglqpgqevgvychsgarsavaffvlrsl gvrarnylgsmhewlqeglptep
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.249
    Matthews' coefficent 2.52 Rfactor 0.222
    Waters 414 Solvent Content 51.10

    Ligand Information
    Ligands SO4 (SULFATE) x 7
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch