The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the truncated extracellular domain of mouse CD38. To be Published
    Site RSGI
    PDB Id 2eg9 Target Id ar_001000812.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS12221, Molecular Weight 27646.25 Da.
    Residues 241 Isoelectric Point 6.33
    Sequence rsllvwtgepttkhfsdiflgrcliytqilrpemrdqncqeilstfkgafvsknpcditredyaplvkl vtqtipcdktlfwskskhlahqytwiqgkmftledtllgyiaddlrwcgdpstsdmnyvscphwsencp nnpitmfwkvisqkfaedacgvvqvmldgslrepfykdstfgsvevfsldpnkvhklqawvmhdiegas snacsssslnelkmivqkrnmifacvdnyrparf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.34
    Matthews' coefficent 2.00 Rfactor 0.263
    Waters 23 Solvent Content 38.37

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch