The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Hypothetical Protein(AQ1494) from Aquifex aeolicus. To be Published
    Site RSGI
    PDB Id 2egi Target Id aae001001494.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12067, Molecular Weight 15284.93 Da.
    Residues 128 Isoelectric Point 7.76
    Sequence mpfiyrrrvqfyetdaqgivhhsnyfryfeeargeflrskgfpyskmrdmglevvllnayceykkplfy ddvfevhlnleelsrftftfsyivfkediavakantkhcmvkngkivsipkevlevlkd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.282
    Matthews' coefficent 2.22 Rfactor 0.24
    Waters 286 Solvent Content 44.70

    Ligand Information
    Ligands GOL (GLYCEROL) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch