The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Hypothetical protein (AQ1549) from Aquifex aeolicus. To be Published
    Site RSGI
    PDB Id 2egt Target Id aae001001549.4
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12074, Molecular Weight 15011.84 Da.
    Residues 132 Isoelectric Point 7.70
    Sequence mevkevelelsseatflsktsigeitagekglnpmelllvsigscsgvdvyhilkkkrqevkdikiflk gkrrekhpkiyeeieikyvavgkveekaleqavklstekycsvlamvkpstnlkiswevkwee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.23
    Matthews' coefficent 2.47 Rfactor 0.211
    Waters 74 Solvent Content 50.17

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch