.
The Open Protein Structure Annotation Network
PDB Keyword
.

2egv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of rRNA methyltransferase with SAM ligand. To be Published
    Site RSGI
    PDB Id 2egv Target Id aae001000165.2
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12027, Molecular Weight 26681.71 Da.
    Residues 229 Isoelectric Point 7.70
    Sequence mhvfyseerrgnllilregevkhfrvrriekdeefgvihegkiyvckvrredkreisceiveeletklp pkditlyqsvtvdlktmdtivrqatelgvltfvpiisersfqkeeailkktekwkrivieamkqsrrpi pmeikkpvrlsdlipeseeniildnfyegvkpkdvnleaktysvvvgpeggfskresqilrekgfksvl lepytlrtetavvsivsilmnf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.45 Rfree 0.245
    Matthews' coefficent 2.19 Rfactor 0.218
    Waters 314 Solvent Content 43.94

    Ligand Information
    Ligands SAM (S-ADENOSYLMETHIONINE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch