The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of rRNA methyltransferase with SAH ligand. To be Published
    Site RSGI
    PDB Id 2egw Target Id aae001000165.3
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12028, Molecular Weight 26681.71 Da.
    Residues 229 Isoelectric Point 7.70
    Sequence mhvfyseerrgnllilregevkhfrvrriekdeefgvihegkiyvckvrredkreisceiveeletklp pkditlyqsvtvdlktmdtivrqatelgvltfvpiisersfqkeeailkktekwkrivieamkqsrrpi pmeikkpvrlsdlipeseeniildnfyegvkpkdvnleaktysvvvgpeggfskresqilrekgfksvl lepytlrtetavvsivsilmnf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.307
    Matthews' coefficent 2.12 Rfactor 0.226
    Waters Solvent Content 42.00

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch