.
The Open Protein Structure Annotation Network
PDB Keyword
.

2egx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the putative acetylglutamate kinase from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2egx Target Id ttk003000046.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14205, Molecular Weight 29052.06 Da.
    Residues 269 Isoelectric Point 8.49
    Sequence mivvkvggaeginyeavakdaaslwkegvklllvhggsaetnkvaealghpprflthpggqvsrltdrk tleifemvycglvnkrlvellqkeganaiglsgldgrlfvgrrktavkyvengkvkvhrgdytgtveev nkalldlllqagylpvltppalsyeneaintdgdqiaallatlygaealvylsnvpgllarypdeaslv reipveriedpeylalaqgrmkrkvmgaveavkggvkrvvfadgrvenpirralsgegtvvr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.92 Rfree 0.242
    Matthews' coefficent 4.78 Rfactor 0.225
    Waters 252 Solvent Content 74.24

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch