.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eh2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Mutant V18M structure of PH0725 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2eh2 Target Id pho001000725.54
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13906, Molecular Weight 29606.84 Da.
    Residues 265 Isoelectric Point 5.76
    Sequence mvlyfiglglyderditmkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsredvelnfen ivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysavgitglhiykfgksatvay pegnwfptsyydvikenaerglhtllfldikaekrmymtaneamelllkvedmkkggvftddtlvvvla ragslnptiragyvkdliredfgdpphilivpgklhiveaeylveiagapreilrvnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.232
    Matthews' coefficent 3.15 Rfactor 0.195
    Waters 463 Solvent Content 60.90

    Ligand Information
    Ligands SO4 (SULFATE) x 4;SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 1;MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch