The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of aq_1058, a transcriptional regulator (TerR/AcrR family) from Aquifex aeolicus VF5. To be Published
    Site RSGI
    PDB Id 2eh3 Target Id aae001001058.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12054, Molecular Weight 21553.27 Da.
    Residues 179 Isoelectric Point 8.36
    Sequence mgtkerilevskelffekgyqgtsveeivkranlskgafyfhfkskeeliteiierthkkiislfeenk ektpeellemflevlyrekkvvyiflfdllcsekfrniyfekiedakrrfekflekhfpskaeilseii lgflrqlilhyvikeerelpflkeklreglklifegvkkcg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.221
    Matthews' coefficent 2.31 Rfactor 0.206
    Waters 202 Solvent Content 46.71

    Ligand Information
    Metals MG (MAGNESIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch