The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of acetylornithine aminotransferase from Aquifex aeolicus VF5. To be Published
    Site RSGI
    PDB Id 2eh6 Target Id aae001000023.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12019, Molecular Weight 42007.28 Da.
    Residues 376 Isoelectric Point 7.15
    Sequence mtylmnnyarlpvkfvrgkgvylydeegkeyldfvsgigvnslghaypkltealkeqvekllhvsnlye npwqeelahklvkhfwtegkvffansgtesveaaiklarkywrdkgknkwkfisfensfhgrtygslsa tgqpkfhkgfeplvpgfsyaklndidsvyklldeetagiiieviqgeggvneasedflsklqeickekd vlliidevqtgigrtgefyayqhfnlkpdvialakglgggvpigailareevaqsftpgshgstfggnp lacragtvvvdevekllphvrevgnyfkeklkelgkgkvkgrglmlglelereckdyvlkalekgllin ctagkvlrflppliiqkehidraisvlreil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.221
    Matthews' coefficent 2.47 Rfactor 0.198
    Waters 506 Solvent Content 50.24

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch