.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eh9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the HBAF250B at-rich interaction domain (ARID). To be Published
    Site RSGI
    PDB Id 2eh9 Target Id hsk002001209.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12639, Molecular Weight 13388.66 Da.
    Residues 118 Isoelectric Point 8.56
    Sequence ekitkvyelgneperklwvdryltfmeergspvsslpavgkkpldlfrlyvcvkeigglaqvnknkkwr elatnlnvgtsssaasslkkqyiqylfafeckiergeepppevfstgdt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.222
    Matthews' coefficent 2.38 Rfactor 0.197
    Waters 65 Solvent Content 48.30

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 3;ZN (ZINC) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch